PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100169980041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family NAC
Protein Properties Length: 147aa    MW: 17500.3 Da    PI: 8.6249
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100169980041genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM67.53.8e-21474167
                           NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkk 67
                                  +p GfrF Pt+eel+++yL++k+e++++++++vi++vdiy+++Pw+Lpk     +++++++w+fF++r+++
  Ote100169980041|100169980041  4 MPTGFRFFPTEEELISFYLQNKLEDNNTNINRVIPTVDIYQLDPWHLPKqcgeLCHGDTEQWFFFMPRQER 74
                                  699***************************99****************645543344677*******9986 PP

2NAM36.21.8e-117410597128
                           NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                                   +e++g+kk++vfykg+ap+g+kt+W m+eyr+
  Ote100169980041|100169980041  74 REVIGVKKSMVFYKGKAPTGRKTKWKMNEYRA 105
                                   6789**************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-373128IPR003441NAC domain
PROSITE profilePS5100519.8854147IPR003441NAC domain
PfamPF023652.9E-155104IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MEEMPTGFRF FPTEEELISF YLQNKLEDNN TNINRVIPTV DIYQLDPWHL PKQCGELCHG  60
DTEQWFFFMP RQEREVIGVK KSMVFYKGKA PTGRKTKWKM NEYRAIKEDA NTSMPMLRHE  120
MCLCRVYVVS GSLRAFDRRP THVAIRM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012838527.12e-75PREDICTED: NAC domain-containing protein 90
SwissprotQ9FMR32e-58NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A022RAV32e-75A0A022RAV3_ERYGU; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000677072e-67(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357